PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_15530.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 390aa    MW: 43895.1 Da    PI: 6.2392
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_15530.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.1e-161966148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+ Ed +l ++v+++G g+W+++ +  g+ R++k+c++rw ++l
  Rsa1.0_15530.1_g00001.1 19 KGPWTATEDAILTEYVRKHGEGNWNAVQKNSGLFRCGKSCRLRWANHL 66
                             79******************************************9986 PP

2Myb_DNA-binding49.87.6e-1672115146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g++++eE++ +++++++lG++ W++ a+ ++ gRt++++k++w++
  Rsa1.0_15530.1_g00001.1  72 KGSFSPEEEKMIIELHARLGNK-WARMASQLP-GRTDNEIKNYWNT 115
                              799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.6841466IPR017930Myb domain
SuperFamilySSF466896.74E-3016113IPR009057Homeodomain-like
SMARTSM007172.0E-141868IPR001005SANT/Myb domain
PfamPF002491.7E-141966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-232073IPR009057Homeodomain-like
CDDcd001677.67E-112166No hitNo description
PROSITE profilePS5129424.33267121IPR017930Myb domain
SMARTSM007171.2E-1571119IPR001005SANT/Myb domain
PfamPF002494.7E-1572115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2574120IPR009057Homeodomain-like
CDDcd001674.47E-1174115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MDGGGETRVT EAKVRGMKKG PWTATEDAIL TEYVRKHGEG NWNAVQKNSG LFRCGKSCRL  60
RWANHLRPNL KKGSFSPEEE KMIIELHARL GNKWARMASQ LPGRTDNEIK NYWNTRMKRR  120
QRDGLPLYPQ ETQHQGVGND DDDQFEFNSF QFQNQDHGNH QNMLQYTNSS NTPSSSSSFS  180
SSSSQPSKRL CVDPLISSNP GLNQIPESPM NFPMFSYYSN SLENNHSLEN DNNNQFIKYS  240
SSSSNEFCNP NQVLELPSEN SDTNNTNRKD TDAMSYSSLL MGDHETKPSC FPFGLDNTLL  300
ELPSSKTPTH WFTSNTLLDD GVHLDPPAGN SGLLDAVLEE SQALSRRGNF NDSTVSSGGL  360
GEDQDKRVKM DWENRLINHN PSHLSSFGKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-29191204104C-Myb DNA-Binding Domain
1msf_C2e-29191204104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009143995.10.0PREDICTED: myb-related protein 306-like
TrEMBLA0A078IFW70.0A0A078IFW7_BRANA; BnaA05g10900D protein
STRINGBra005597.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51002747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.11e-165myb domain protein 101